PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA46G00202
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 348aa    MW: 37794.3 Da    PI: 7.5729
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA46G00202genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.24.6e-191358147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd+ll ++v+++G+++W++I+r +  gR++k+c++rw + 
       AA46G00202 13 KGPWSPEEDDLLQKLVNKHGPRNWSLISRSIS-GRSGKSCRLRWCNQ 58
                     79******************************.***********985 PP

2Myb_DNA-binding54.72.4e-1767109347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++eEde +++a++++G++ W+tIar ++ gRt++ +k++w++ 
       AA46G00202  67 AFSAEEDETIIRAHARFGNK-WATIARLLN-GRTDNAIKNHWNST 109
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.316863IPR017930Myb domain
SuperFamilySSF466894.31E-3110106IPR009057Homeodomain-like
SMARTSM007171.1E-161261IPR001005SANT/Myb domain
PfamPF002492.9E-181358IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-251466IPR009057Homeodomain-like
CDDcd001671.39E-151557No hitNo description
SMARTSM007171.4E-1464112IPR001005SANT/Myb domain
PROSITE profilePS5129420.56965114IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2267113IPR009057Homeodomain-like
PfamPF002498.9E-1567109IPR001005SANT/Myb domain
CDDcd001678.30E-1267110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MSGSSRREME RIKGPWSPEE DDLLQKLVNK HGPRNWSLIS RSISGRSGKS CRLRWCNQLS  60
PEVEHRAFSA EEDETIIRAH ARFGNKWATI ARLLNGRTDN AIKNHWNSTL KRKCTVMVSD  120
DGHSSDFGGN GGYDGNLTDE KPLKRAASVG IGGVVSTGLY MSPGSPSGSD VSEQSCGPVL  180
QSSHVFKPTA RAGGVVIPTV EVTSSSSAKD PPTSLSLSFP PWIDLRETVT ETVTKTVKVN  240
ESTDLNPEID GGLTAKLFPV RKEEEEEEKE KKQRGLSGFN GEFMTVLQEM IKTEVRSYMA  300
DLQVGNNNGG GNGGNNGGSC MLQGSSNGRH VGFREFIAMN HIGIGKIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-40101131104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00632PBMTransfer from PK28565.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001303071.11e-157transcription factor MYB44
RefseqXP_009137661.11e-157PREDICTED: transcription factor MYB44
SwissprotQ9FDW15e-97MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0A7BWH51e-157A0A0A7BWH5_BRANA; MYB transcription factor 73
TrEMBLM4D5J21e-157M4D5J2_BRARP; Uncharacterized protein
STRINGBra011749.1-P1e-156(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-139myb domain protein 73